SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602213|ref|YP_502391.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602213|ref|YP_502391.1|
Domain Number 1 Region: 17-224
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.74e-61
Family Phosphate binding protein-like 0.0000528
Further Details:      
 
Domain Number 2 Region: 227-299
Classification Level Classification E-value
Superfamily GlnB-like 1.22e-21
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88602213|ref|YP_502391.1|
Sequence length 300
Comment ATP phosphoribosyltransferase [Methanospirillum hungatei JF-1]
Sequence
MTKNSSPISDRTPVFHVRIAIPNKGRISVPIRELIEKSGLGIIDNGDRTLIARTRDQHVE
ILYARPIDIPEYVASGVADLGITGHDMVVERGSAVTELLNLGFGSASVVLAVPENSNLNS
PKDLNGKRVSTEFPAITRKYFKKAGIIPIIVPVGGACEATPSLGISDAIVDISSSGSTLR
QNHLKIIDTVLETSTYLIANPRSCIDKKEKIDEIHLALESVLNARGKCYLMMNVIRSSLD
DIRTIIPGMGGPTIMDVASSADMVAVHAVVDEEKVYQLINRLKQAGARDILVMNIERLIR
Download sequence
Identical sequences Q2FN16
gi|88602213|ref|YP_502391.1| 323259.Mhun_0922 WP_011447951.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]