SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602223|ref|YP_502401.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602223|ref|YP_502401.1|
Domain Number 1 Region: 44-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.000000000417
Family GHMP Kinase, N-terminal domain 0.016
Further Details:      
 
Weak hits

Sequence:  gi|88602223|ref|YP_502401.1|
Domain Number - Region: 259-325
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0504
Family Galactokinase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88602223|ref|YP_502401.1|
Sequence length 355
Comment GHMP kinase [Methanospirillum hungatei JF-1]
Sequence
MTILKIRGGDLDLVEYDFTSFHPGENMNTCGFEKSYSLSPVKTPVRTQAPGRIHLTVLDM
NRFAPGHPGGGGIGFAIDVFAEVEVRCIEKGFEINYSRPAIIKHFLLVFSKTVGYTGGFS
VTAKDHDYKHVGLGSTSTILTALSAAVNRALGDPLTLDQLRILIGNNYVEETEGGMIAYG
FETGVGPAVSGRGGMAILGDNLTVVHQHIFAKGKNVHIVIPPSSISSAGEEEFSLLMNKA
RSLDYRDRELKAYIVMMDFIPALNQDDLKKMGDSMWEMEFRGSKRAEIEHHSFELYQYMH
KLRKAGLEFIGMSSVGPSIAVITDMSREKLSSILTPLQLEIAVSTKVNNSGLVFL
Download sequence
Identical sequences Q2FQW2
WP_011447961.1.85653 gi|88602223|ref|YP_502401.1| 323259.Mhun_0932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]