SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602283|ref|YP_502461.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602283|ref|YP_502461.1|
Domain Number 1 Region: 75-265
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.23e-39
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 382-484
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000621
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88602283|ref|YP_502461.1|
Sequence length 513
Comment chemotaxis protein CheR [Methanospirillum hungatei JF-1]
Sequence
MSDVLDEAAIGTIRDFILANTGILFDDRHTHDLCRHIASACTDLKIPLETCVQQVNDSSF
QVRFLEILVNYITIGETYFFRDKNLFLFLRDSLLPDLIRSRRQEHKLYLRIWSAACSSGE
EPYSLAILLRYLLVDVDDWDIYLLATDINQHMLNRAQEGLYSRWSFRDDPLIPIGSYFSP
TPDNRMKIDDSVRTMVRFERMNLIHDSSFYNALGPSSLDLILCRNVLMYFSPEQSGEVVS
HLVTSLRTGGFLIVSPQEIGIVQGQFIRMHHHGSVFLHEKVDQNNLVAAEKISPSLSTTF
YSDESVPVTRVIEGDLFHEPDIHDIPDFPGDIFLDEENKPGDSSGVVYLLEPDDEGFDRL
ISENRLEEAGKMISQSAPQSSPHWIRQMEILIRAYAGNGEYDKALGWSDRLIAADVLNPR
PYLLKAAVLDEQGLYNHSLQSLRQSLYAFPDYLPAHLAIAGIYKKTGRPDLARHHYELAI
HILDSKDEDTILEETEGIPARKMKDMIQMLLGG
Download sequence
Identical sequences Q2FQU3
gi|88602283|ref|YP_502461.1| 323259.Mhun_0992 WP_011448021.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]