SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88602365|ref|YP_502543.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602365|ref|YP_502543.1|
Domain Number 1 Region: 33-232
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.44e-32
Family Precorrin-6Y methyltransferase (CbiT) 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88602365|ref|YP_502543.1|
Sequence length 250
Comment hypothetical protein Mhun_1075 [Methanospirillum hungatei JF-1]
Sequence
MDTSSVFKVFESLPRLGGGDDEHTKKAFLFITDLPPGGGEILDVGCGKGAQTMALARLCQ
SCRIRAVDIHQPYIDTLEEKIIVEGFSGRIKTVCASMDNLPFEEESFDIIWAEGCASIIG
IEQAVRYWKKFLKLGGYIMISDIFWFTKTPSEEPREFFAEFHPTMITEDEGFEIVRNAGL
ELVGSFRLPSQVWEESFYGQLRERFGGLEEEYADDKDALMVIDGLKKQTDIFDRYSDEFG
NTYLIMRKSL
Download sequence
Identical sequences A0A1V5SWZ7 Q2FMQ7
323259.Mhun_1075 gi|88602365|ref|YP_502543.1| WP_011448102.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]