SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602410|ref|YP_502588.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602410|ref|YP_502588.1|
Domain Number 1 Region: 1-352
Classification Level Classification E-value
Superfamily tRNA-guanine transglycosylase 5.89e-101
Family tRNA-guanine transglycosylase 0.000000009
Further Details:      
 
Domain Number 2 Region: 360-443
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.000000000347
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88602410|ref|YP_502588.1|
Sequence length 489
Comment 7-cyano-7-deazaguanine tRNA-ribosyltransferase [Methanospirillum hungatei JF-1]
Sequence
MTLSFEILEKDIAGRIGKLSGQGKIVKTPTLLPVINPHLNLIPPKEMQEMGVEAVITNAY
IFSRSEEYRERALTDGLAKTLDFDGVIMTDSGSFQLSVYGEVEITNAQTIAFQQAIKSDI
IVPLDIPTHPDSPREQVEQELSVTMDRIMEAKDIADHEHHTLAGPVQGGLFPDLREETGR
RLSEAGFRFCPIGAVVPLMESYRYAELVKVVMAAKRGLSPAVCVHLFGAGHPSMFALAVA
MGCDLFDSAAYALYAKDGRYMTTHGSYHLNELSYLPCPCPVCVGHTAKELNESPDRERLL
AMHNLRVSLAEINRVRQAIRDGVLWELVDERCRSHPALLRGYRTLLGYNEELTALDRETK
RRFFYRGDESCKRTEVVRYHQMVGRLTAGERTLISFSRHIKKKQTEEYDSVFYFKPPFGP
FPAELTETFPIGQSEIPDFDEEMIKTGCIGIARLMETNPDSHFTIRCRPVWKDLITQILP
TVEVQDEGS
Download sequence
Identical sequences Q2FUA5
323259.Mhun_1120 WP_011448147.1.85653 gi|88602410|ref|YP_502588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]