SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602450|ref|YP_502628.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602450|ref|YP_502628.1|
Domain Number 1 Region: 13-94
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 4.58e-22
Family GIY-YIG endonuclease 0.0058
Further Details:      
 
Domain Number 2 Region: 182-234
Classification Level Classification E-value
Superfamily C-terminal UvrC-binding domain of UvrB 0.000000000119
Family C-terminal UvrC-binding domain of UvrB 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88602450|ref|YP_502628.1|
Sequence length 520
Comment excinuclease ABC subunit C [Methanospirillum hungatei JF-1]
Sequence
MVSIDLTTIPEEPGCYQFKDETGTILYVGKAKNLKKRVSSYFQKKSITPRIDILVSLIRD
IDVIVTSSEVEALILENNLIKKYQPKYNIDLKDAKSYAFIQISNDPFPRIGIARDRTVKK
TGTLYGPFVSAAERDQILKFVKQTFHLRTCKKMTKRACLRSHLGTCAAPCTGKISEPEYQ
YLVKSADYLLKGKSQDLIYDLRKEMETFAAAEEYEKALVIRDRIAAIENLSERQYVQRQK
KSDEHIINYLVSGDTVYLILFHVERGSLTSKEEFVFPETEDFLDEFILQYYSSTKPPNEL
ILPSLPGSGMEEYLTHIRGSHVTLTIPKQGEKKHLLDLAYKNLEVSFFTGKMRLAELGEA
LHMDTAPEVIECFDISHLRGTGTVASMVSFRDGKPDKRNYRRYKINSAGPSDDYAAMAEV
VKRRYSRLLREKSPMPDLIVVDGGPGQLKSAHAILEELSLPIPIISIAKREEEIYIPGRN
TPLSIQKKSPASLLIQEIRDEAHRFAITYQKKLRQKSIKE
Download sequence
Identical sequences Q2FPC6
WP_011448187.1.85653 gi|88602450|ref|YP_502628.1| 323259.Mhun_1161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]