SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602724|ref|YP_502902.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602724|ref|YP_502902.1|
Domain Number 1 Region: 99-367
Classification Level Classification E-value
Superfamily TPR-like 1.37e-47
Family Tetratricopeptide repeat (TPR) 0.0072
Further Details:      
 
Domain Number 2 Region: 343-666
Classification Level Classification E-value
Superfamily TPR-like 8.72e-45
Family Tetratricopeptide repeat (TPR) 0.0049
Further Details:      
 
Domain Number 3 Region: 685-900
Classification Level Classification E-value
Superfamily TPR-like 5.24e-32
Family Tetratricopeptide repeat (TPR) 0.0095
Further Details:      
 
Domain Number 4 Region: 2-131
Classification Level Classification E-value
Superfamily TPR-like 2.32e-27
Family Tetratricopeptide repeat (TPR) 0.0038
Further Details:      
 
Domain Number 5 Region: 835-1045
Classification Level Classification E-value
Superfamily TPR-like 4.93e-27
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88602724|ref|YP_502902.1|
Sequence length 1067
Comment tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
Sequence
MGMAFLKKDQQDRAYYAFKEGLRIDPENSELWYQTGIVLAKQERHRDAMKMYRNALKYDP
DNLQAQLRLGMSMHEVGMYKEAIPVLTRLVERESENDQGWMYRGACYLALGKFREALTDL
DMAIDWGAEQAEVWVLKGYCHVQLGEYTDALDAYYFAIEINPDDPVAFFGLANTLVHLEE
REQAIDALKKALKIDPDYADAWRMIADLLADSGDIPQATSAYEHVLKLEPWDLDTRYSYS
ILKAELSDDKAAVTDILNQIINEGQESVTFYNNHGLTLMHLKKYDSALQAFNRALQLGKD
NPSVWHNHGAALYKLKWYKDAMKSFQQSLKLNPKNVNSWVGIGMVAVAQYEFSRAAAAYT
HAAQLSPRKVNIWIMLGDTQIERGQYQEAIAAYEKALELDPENPTAWNQRGLALRLLDSH
PAALESFEHAAETKNAKPESWINHAITSFELGEYHQSVHSFERACKFGPIPSDSWLIYLN
ALAYEHENQKLIKASERFIELFGPDAEVLFLLGVAQYELKQYEAALHHFRETLKLDKDHT
DALFWAGLTLLELYQFTEAITAFEGVEDNHPDDDQAWYYHGKALVALHELQKAEFILKHS
LQLNDQSADAWYLLADVQHTRKAYADALQSVGKALDLSPSNNEILKLKAKIQVALGSFRG
ACQTYAAISEPDASDTEVLTGYMRALYHTGQFREAYSRVTRLLVKDEKNPDLWRMRAEIE
RAQGLFDEAANALTEACKYAPNNKKLLSLQAIVLYEAEKYPEAISVIDKVLGFDPLNGEL
WKRKGAAHDSLQQYDQACESYLKAAEFLQDDPDLIRKLGVALYKTGKCDKSLPRFDQYLE
VVPDDPEIWEMKGKALFHQGKYESASAALSQAILYRPDDMDLLFRYAQSLIKSGELLTAI
PPLDQVIEQNPENAEAWKLKAEIEQTLGREDEAAQAVEEALRQIPDDPGLMLARVKSLYE
ADSYAEGLSLVRRLIDKTPESTEAWSLYAELLWMTADHNAAAAAFDRILALDDTNAKAWF
LKGDSLQNAGRFEEAAVAHERAFSLGGDPSVGLMLSRKMRYLQQKKA
Download sequence
Identical sequences Q2FNJ8
gi|88602724|ref|YP_502902.1| 323259.Mhun_1449 WP_011448452.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]