SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602778|ref|YP_502956.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602778|ref|YP_502956.1|
Domain Number 1 Region: 46-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.19e-47
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 684-855
Classification Level Classification E-value
Superfamily TPR-like 6.45e-22
Family Tetratricopeptide repeat (TPR) 0.0084
Further Details:      
 
Domain Number 3 Region: 610-708
Classification Level Classification E-value
Superfamily TPR-like 0.0000387
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88602778|ref|YP_502956.1|
Sequence length 862
Comment TPR repeat-containing serine/threonine protein protein kinase [Methanospirillum hungatei JF-1]
Sequence
MIPEDVDSPEKRGRTLRDGLSAQFEPSHQAEPDIAGSESQRYFRTYRIMKQFPATGGEAD
IWLIQKDRVYYILKHYRLGIEPKIDVLDQVSHISLRNPKNLIKIIDYGFDEDSERWYEIL
EYARYGSLRDLVQKQSINNNTFKAIIEEIAFGLDTLHKNNVLHLDLKPSNILIRELRPLN
LILTDFGISTLLDSELSRHITTTKGTPMYWAPEQLGNVVGRESDYWALGVIALELTEKKH
PFDGLNHNLILSTLASRGIILSEQINPDRLILLKGLLTRNPKKRWGKREVSLWLSGKRNI
PVYYEEEHTGRMGISKPYEFHDENYYSLHDLMYAFIGDPVSWEDAKRHIGRGYLLRWLEA
TEQYNKAVTISKYIETYPNEDERLLYIAAELNRDIPFTLFGKVIDITNIVWFLGRSLNRE
QDENEERIIIMLFSGEIEEMYTKFLEITKQEVKSIFFMRLFAWIKSNPRGTNERKRLFQY
AKILHERELAGIPTEWSAKSVIAIVSIYQNFIKLSAKSDADECKKDMIAAAKHALAAQVI
EPDLLVALASAFEELQDEKSGKLLLKKAYNLDIRVLTLLFNKRKGLPRFRFYTALTREYE
KNLISISSDPWNETATFWKEKYVQYYLEDNFSLALSISERLIEMDKAGAVGWAMRGVSLF
KLKRSHEAGFCLSHKVIQTSDDPFITWLTGEHLEETGNPALAEQKYLQVPIVHIAQPVPQ
IGLARLYFKQKRYWESIEICDKILATYPGLPKALFYKGESLYAIERVPEALQSFLDICNN
HPDHLQSCVKAARCYLKLGDYTEADKYITGVIEKDETIIEALRIKVFILLKRGAKAEARL
YLDKILVIDPENEWAQRMLAIK
Download sequence
Identical sequences Q2FNS1
WP_011448506.1.85653 323259.Mhun_1503 gi|88602778|ref|YP_502956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]