SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88602813|ref|YP_502991.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602813|ref|YP_502991.1|
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 7.4e-35
Family HxlR-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88602813|ref|YP_502991.1|
Sequence length 121
Comment transcriptional regulator [Methanospirillum hungatei JF-1]
Sequence
MNEKGPYHCPVEAALAVIGGKWKALIIWQLKGGTLRFTQLTERLPMVSPRMLTKQLRELE
DDGVISRKIYPEVPPRVEYSLTALGTSVIPVLESLCAWGSEYLLHNGCPLPEKNCQGESS
T
Download sequence
Identical sequences Q2FNV2
WP_011448537.1.85653 323259.Mhun_1541 gi|88602813|ref|YP_502991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]