SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602825|ref|YP_503003.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602825|ref|YP_503003.1|
Domain Number 1 Region: 152-271
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.04e-26
Family MJ1460-like 0.021
Further Details:      
 
Domain Number 2 Region: 40-148
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000115
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88602825|ref|YP_503003.1|
Sequence length 278
Comment ArsR family transcriptional regulator [Methanospirillum hungatei JF-1]
Sequence
MYANKYEPSGLYVHAAVTEEYTKNLDDDIQLFSSRNRVMAIDSQVKKRILELLQSRDHSF
YEIVTLCGKAKSTISVHVHDLLKAGLISSHTDPDDSRKKILSLTSHPIGRLTNLDRHAPV
REDKSEVSARLPFEPGDIASFFRWGVRVFRTEAMALGINVDPVLERTGWEIGRVLAPLVY
DSDLSRMVEKMHEFWSVHGLGSVTLSGSDPISLTVQGCFECEDLPVTGHGACSFDIGVLS
AIFSGYLNEPVRITEIECYSAGHDHCKFIIEQKARVNR
Download sequence
Identical sequences Q2FNS5
gi|88602825|ref|YP_503003.1| 323259.Mhun_1553 WP_011448549.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]