SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602867|ref|YP_503045.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|88602867|ref|YP_503045.1|
Domain Number - Region: 197-259
Classification Level Classification E-value
Superfamily TPR-like 0.00759
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88602867|ref|YP_503045.1|
Sequence length 397
Comment hypothetical protein Mhun_1595 [Methanospirillum hungatei JF-1]
Sequence
MKTGSLIIFLSIIFCFIAIPAMASVEVGHVNVKPSGDLESGKSNVSADLQLSFVSIGGTT
FPSDESISLKTELENPVWTYSIILDGVENPRPAVSKKQLDLSGWELSYENVDESVKVNLK
GMAPKVDSSKEIEIVSVNVATPGGRVKETVKNVTAFVTNPGELKGDISTVKDAYSKLEKD
IAQNKADGIDVSKAEAKAKEALTSLNSAAGASYSNAQIYIKNANTYIKDAYAMLDMGLSQ
KAIKDAKEAIDKTDEWINYFKTEKELGSDPRLAPIITKREFAAEDASDAKELYDAGKYTE
ARKKAEEAYQKADEVFTATQDLNAELEAAPKGFQFPDLSGIIPYIIGIIVVAIVGFALFR
IMKNRGGKGGGKGGGGSFGSRDKPKKKSTAHQYDELF
Download sequence
Identical sequences Q2FQX8
WP_011448591.1.85653 323259.Mhun_1595 gi|88602867|ref|YP_503045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]