SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602898|ref|YP_503076.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602898|ref|YP_503076.1|
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Flavoproteins 2.1e-41
Family Hypothetical protein SP1951 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88602898|ref|YP_503076.1|
Sequence length 220
Comment NADPH-dependent FMN reductase [Methanospirillum hungatei JF-1]
Sequence
MQVVGINSSPRKKSNTDLLLTTVLTGASDGGCKTVHIDLYNYEIEYCKACDTCYKTGSCV
LMDEFPDIYEVILESDGIILSSPNYINNVTAKMKTLLDRMADTVHCQRLLGKYSAAVSTA
GGSGAQEVADYLNQSLFIMGASVVGSVGVNLADGEEMFQKGVDQSYQLGIQLADAILTKA
EYPDQQQGHAAMLERMKQLVSFRREEWPYEYEYFTHKKWI
Download sequence
Identical sequences Q2FR50
323259.Mhun_1626 gi|88602898|ref|YP_503076.1| WP_011448622.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]