SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602900|ref|YP_503078.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602900|ref|YP_503078.1|
Domain Number 1 Region: 1-163
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-63
Family Formaldehyde-activating enzyme, FAE 0.0000337
Further Details:      
 
Domain Number 2 Region: 97-385
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.16e-46
Family Decarboxylase 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88602900|ref|YP_503078.1|
Sequence length 393
Comment bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase [Methanospirillum hungatei JF-1]
Sequence
MYLIGEALIGEGSELAHVDLIVGDKNGPVGMAFANALSQLSAGHTPLLAVVRPNLLTKPA
TVVIPKVTLKNEGQVNQMFGPVQAAVAKAVADAVEEGLFGDININDICILASAFLHPSAK
DYNRIYRYNYGATKLAISRAFEEFPDEKTLIHEKDRAAHAVMGFKVPRLWDPPYLQVALD
IVDLGKLRSVLSSLPENDHLIIEAGTPLIKKFGLNVISEIRAVKPNAFIVADMKILDTGN
LEARMAADSSADAVVMSGLAPASTIEKAITEARKTGIYSVIDMLNVEDPVGLIASLKVKP
DIVELHRAIDAEHTSHAWGNIGDIKKAAGGKLLVATAGGIRVPVVKEALKTGADILVVGR
AITASKDVRHAAEEFLEQLNKEEIDQFRIMTDF
Download sequence
Identical sequences A0A1V5SMS6 Q2FQ74
323259.Mhun_1628 gi|88602900|ref|YP_503078.1| WP_011448624.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]