SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603074|ref|YP_503252.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603074|ref|YP_503252.1|
Domain Number 1 Region: 2-575
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.83e-206
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.000000000866
Further Details:      
 
Domain Number 2 Region: 535-684
Classification Level Classification E-value
Superfamily ADC-like 8.59e-49
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88603074|ref|YP_503252.1|
Sequence length 688
Comment formate dehydrogenase, subunit alpha [Methanospirillum hungatei JF-1]
Sequence
MDLKYVQTTCPYCGTGCSLNLVVKDGKVVGTAPYHRSPVNEGKLCPKGTYAHEFINSPDR
LTKPLIKKDGKFVEATWDEALKLIAEKFKSYKPDECACLASARVSNEDNYAMMKFARGVL
KTKHIDHCARLCHASTVAGLANIFGSGAMTNSIGDIADSKCVFIIGSNTFECHPLIGRRV
MQAKAKGAKFIYADPRLTATGKQADLYLQFRSGTDVALFNGMMQEIIKNGWEAKDFIEKR
CNGFDELKKEVMKDEYSLENVSSITGVPVDQIKTAAEWVAKSGATAILYSMGITQHTTGV
DNVKSVGNLQMLTGNLGRPGTGVNALRGQNNVQGACDMGCLPVVYTAYQKVIDEAAQKKF
ADAWKFPDGIAKGENGYEVTTLMNVLTEKPGEIKCLYIMGENPMISDPDLTHVEHALKTL
DFLVVQDIFLNETAEFADVVLPAACYAEKDGTQTSTERRVQMWRKAQDPPGEAKGDWEII
ASIAAAMGYGAQFPWKTSEEVFNEMASLTPSYAGMTYERLNRPEALHWPCPTKEHPGTPI
LHSEKFGMPDGKGLMTAIPFKWPVEVPDEEYPYVLTTGRSIWQWHTGTMTRRSVDLEREE
PTGWIEINTGDAQKLGIKDKELVKAKTRRGEITITARVTDNIKPGVMFIPFHYVECAANM
LTINALDPIAKIPESKACAVRVEKIQEA
Download sequence
Identical sequences Q2FKY1
gi|88603074|ref|YP_503252.1| WP_011448797.1.85653 323259.Mhun_1813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]