SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603086|ref|YP_503264.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603086|ref|YP_503264.1|
Domain Number 1 Region: 211-268
Classification Level Classification E-value
Superfamily TrkA C-terminal domain-like 0.000000693
Family TrkA C-terminal domain-like 0.014
Further Details:      
 
Domain Number 2 Region: 88-169
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000144
Family Apolipoprotein 0.014
Further Details:      
 
Weak hits

Sequence:  gi|88603086|ref|YP_503264.1|
Domain Number - Region: 15-83
Classification Level Classification E-value
Superfamily ADC-like 0.00529
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603086|ref|YP_503264.1|
Sequence length 270
Comment TrkA-C [Methanospirillum hungatei JF-1]
Sequence
MEEATLQAVKRAMPGHGRARIHEKLLSFLGVEDQSEVEVSTDAGATLTLTIFADAMVDEG
TIRISGEDLKKLNIPDGGKVHVTRKIPLEERIRTAAESAAGQIRGGAQEIGSKLSETADK
LQKGAADTAGQISTKAKEITEKVKEDTKPIGEKVSKAAKSSAEAIRDKIPIGKLSPEIEK
GLSAISQEEAKAIRSALTGIEGVSAAVPVRFAAGRSLGNLTIPPEITLVTVQRKDKVLGL
DRDIILKENDIVYFSGPSDAVGFVTRMLEG
Download sequence
Identical sequences Q2FKT1
323259.Mhun_1825 WP_011448809.1.85653 gi|88603086|ref|YP_503264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]