SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88603138|ref|YP_503316.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603138|ref|YP_503316.1|
Domain Number 1 Region: 6-77
Classification Level Classification E-value
Superfamily RelE-like 0.00000000000654
Family YoeB/Txe-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88603138|ref|YP_503316.1|
Sequence length 84
Comment hypothetical protein Mhun_1880 [Methanospirillum hungatei JF-1]
Sequence
MQREHWRNLNKKLVKKSIKIYKNLQKIKSNPYKFIEPLNRPKGAEPLYKLRIGEYRAIMA
IRNNEMVILVVDIGHRKIIYRKYQ
Download sequence
Identical sequences Q2FM41
WP_011448861.1.85653 323259.Mhun_1880 gi|88603138|ref|YP_503316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]