SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603234|ref|YP_503412.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603234|ref|YP_503412.1|
Domain Number 1 Region: 6-437
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.22e-70
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.0000637
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603234|ref|YP_503412.1|
Sequence length 439
Comment molybdopterin oxidoreductase [Methanospirillum hungatei JF-1]
Sequence
MSKTCTDVICPFCGTLCDDLIVTTDDEGKKILNVENACAIGAEKFLHASDHSHRVTRPQK
LQEDGSFKEITYDEAIEYTAQMLANAKKPSMYGWSSTNCESQSVGHEIAELCGALVDNTA
AVCHGTTLIAVQNVGIPSCTLGEVKNRADRVIFWGCNPAHAHPRHMSRYSIFPRGYFTGK
GQKQRKIIVVDPRPTDTASLADVHLQVEQGYDYELLQALRAAVRGNELTGDIIAGVPKEK
VYEAAELLKSGRFGVIFFGMGVTQSLGKDHNIDAAIMLTKDLNDYTKFSIIAMRGHYNVT
GSGQVLGWQFGFPYSVDLSRGFARYNPGETGTIEVLKRKEIDAMFVLGSDPGAHFPMECV
KEISRLPSVAIDPHITPTTAICKVHVPVAFVGVEVGGNCYRMDNVPIEARKVVEPPEGMM
TDEEFLKAVLKRVKELKAN
Download sequence
Identical sequences A0A1V5SVU2 Q2FRC6
WP_011448955.1.85653 323259.Mhun_1983 gi|88603234|ref|YP_503412.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]