SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603271|ref|YP_503449.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603271|ref|YP_503449.1|
Domain Number 1 Region: 8-574
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.45e-195
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.000000000509
Further Details:      
 
Domain Number 2 Region: 526-683
Classification Level Classification E-value
Superfamily ADC-like 8.61e-45
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88603271|ref|YP_503449.1|
Sequence length 686
Comment formate dehydrogenase, subunit alpha [Methanospirillum hungatei JF-1]
Sequence
MSENSEIMKYVATTCPYCGVGCTLNLVVSNGKVVGVEPNQRSPINEGKLCPKGVTCWEHI
HSPDRLTTPLIKKDGKFIEASWDEALDLVAKNLKVIYDKHGPKGLGFQTSCRTVNEDCYI
FQKFARVGFKTNNVDNCARICHGPSVAGLSLSFGSGAATNGFEDALNADLILIWGSNAVE
AHPLAGRRIAQAKKKGIQIIAVDPRYTMTARLADTYVRFNPSTHIALANSMMYWIIKEGL
EDKKFIQDRVNGFEDLKKTVENYADAEAIHGVPLDVVKDIAFRYAKAKNAVIIYCLGITE
LTTGTDNVRSMGNLALLTGNVGREGVGVNPLRGQNNVQGACDMGAYPNVYSGYQKCEVAE
NRAKMEKAWSVTNLPDWYGATLTEQINQCGDEIKGMYILGLNPVVTYPSSNHVKAQLEKL
DFLVVQDIFFTETCQYADVILPGACFAEKDGTFTSGERRINRVRKAVNPPGQAKEDIHII
SELAAKMGFKGFELPTAKDVWDDMRAVTPSMFGATYEKLERPEGICWPCPTEEHPGTPIL
HREKFATADGKGNLFGIDYRPPAEVADAEYPFTLMTGRLIFHYHSRTQTDRAADLHREVP
ESYAQINIEDARRLGIKNNEYIKLKSRRGETTTLARVTDEVAPGVVYMTMHFADGVNNLT
NTVLDPMSKMPELKHCAISIEKVGGN
Download sequence
Identical sequences A0A1V5SNH4 Q2FRK1
gi|88603271|ref|YP_503449.1| 323259.Mhun_2021 WP_011448992.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]