SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603309|ref|YP_503487.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603309|ref|YP_503487.1|
Domain Number 1 Region: 785-939
Classification Level Classification E-value
Superfamily TPR-like 4.65e-29
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Domain Number 2 Region: 265-361,413-502
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000321
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 
Domain Number 3 Region: 15-178
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000447
Family Tetratricopeptide repeat (TPR) 0.042
Further Details:      
 
Domain Number 4 Region: 522-620,659-703
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000245
Family CT2138-like 0.072
Further Details:      
 
Domain Number 5 Region: 157-246
Classification Level Classification E-value
Superfamily TPR-like 0.000000962
Family Tetratricopeptide repeat (TPR) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603309|ref|YP_503487.1|
Sequence length 984
Comment tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
Sequence
MEDIPEQEGRSWFDFLITRVTALLDAEEYDQALTQVDMGLSVWKGNLYLLFLKSIVLSYL
KRPDEALRQLYQIYRENPFEEKFRDELGRNLMLQGYYHSALSVLQHYEFMSNGLAGIRKL
FISICHIFTGNPDLAIEYCDGIQSQLGDTPDVTGFMATIHALKALALIHTGEMSAAAEIM
AAVGEEGDKMPLVPYVKGILAWRSGDISAAETFLRASCEDQPQDMQSKVDLAHLLTECGR
EDEALVIRRDISGFYAPPHPEAAPVFRAEELLKSGRYEEAEVFLESAQKSSPDDMDLFIP
YLSSLYFTGRYDDLIRLAETGEKASDAWKAIYLKASALYSSGKIREAIRVLITAAARDRT
NMMFSLLHMKSAGYFKPPSEETPESLALELFMTDGMDAAIPPFEVLAHASGAPEYLVFLC
FCYIMANRGTDAVLISERFADSEEQDFCLIRAIAFRSVGCLHDAEIITQDVLTKSPDSRP
ALNMYVRTLLEQERYRDAYFELSSRKDALSSDCTLLEVFIRCLIRSGEYRDAALTAVRIM
QMNPGRPMDYYLCALACQLEGSFRTGLYAMRENFRICGSSKKNLLMYGRLLLLATEAQEA
AILFSECKNSLPNTAEVRYLHTAARILSGSDKECESVSEYAARFFQAEKGELRAFIGDYR
QAARMLAEEIRQDPDDSSLRITFARVLFELEQYGEALSQLSLAAGRYGYDGEVKDLLEEG
LKMLRLQGPLEDLKTISHTPERYAELLHERAVSLKRYGVVRLAVNVCTTLTNIESDSPIV
SRYQADAYHMLGDLEENEERYVQAIAVYDQLLQNDPDNPVFLAEKGLVLDNLRRFDEAEP
VLLRALELDPSSGVAHSALCWCLSNLGRHEEAVVHGNQAVILMPYEWGAWNNRGLSRLGL
RDFEGAVSDFRQAIRCQPGEVIARRNLCDALAALDDDDAHEEYEQIIVRFGKRAFPEEEE
EMPAQPRVPGRPLKTPVGYMDGYW
Download sequence
Identical sequences Q2FMI1
WP_011449027.1.85653 323259.Mhun_2060 gi|88603309|ref|YP_503487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]