SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603325|ref|YP_503503.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603325|ref|YP_503503.1|
Domain Number 1 Region: 72-299
Classification Level Classification E-value
Superfamily TPR-like 2.09e-36
Family Tetratricopeptide repeat (TPR) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88603325|ref|YP_503503.1|
Sequence length 314
Comment tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
Sequence
MPGLHTLLMRAIMLVWCGLLLVIIPSALCDNSSPPESIDKGLFTGVLNTLTTGYSRSDGT
ADDLLAEGERFLLNGSFSEATRAFDQVLQADPDSSPGWLGLARAQSGAGEQEQALISLEE
FLFRHPDEWQGYLLQGTIQTSLQKYPDAVASYEKALELNTTDALAWAGYGAALYGTGSYE
DARDACQQSLSLRPDLPSAHYWEGKSLFMLGDETGALSSLNHTVSIDPGFIEAYLVISDL
YERSGKGDDALVVITTGLIANPSSFLLWKEKGRLLEDLNRRTEAHHAYEQALSLNPNDSE
IRQRLTNISDGSEL
Download sequence
Identical sequences Q2FMB5
gi|88603325|ref|YP_503503.1| 323259.Mhun_2077 WP_011449043.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]