SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603457|ref|YP_503635.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603457|ref|YP_503635.1|
Domain Number 1 Region: 5-170
Classification Level Classification E-value
Superfamily Trimeric LpxA-like enzymes 7.35e-52
Family Serine acetyltransferase 0.00011
Further Details:      
 
Domain Number 2 Region: 231-308
Classification Level Classification E-value
Superfamily Fe-S cluster assembly (FSCA) domain-like 1.67e-19
Family PaaD-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88603457|ref|YP_503635.1|
Sequence length 327
Comment serine O-acetyltransferase [Methanospirillum hungatei JF-1]
Sequence
MVLSHLREDIQAIISKDPAAKSVVEILLCYPGLHALLLHRIAHKAWIHDWFLTGRFLSHI
ARFFTGIEIHPGAIIGRRVVIDHGMGVVIGETAEVGDDVLIYMGVVLGGTALKNVKRHPT
IGKGVVIGSGASVLGPIYVGEYAKIGAGAVVVRDVPPGATVVGVPGRIAGLEKYTTQDNI
RDSAMPDPTLRVISRLLERQQALEGRIFRLERENALLKGGAELKISGDRDSEVLNALRQV
IDPEIGHNIVDVDLIRSITITDTLVKIEMEINCDACPLQDYLIDQASARVRLIPWVSDVE
ITIIHDPWDWKISQENAEFSSVFEKKL
Download sequence
Identical sequences A0A1V5T218 Q2FSH7
323259.Mhun_2211 WP_011449174.1.85653 gi|88603457|ref|YP_503635.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]