SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603644|ref|YP_503822.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603644|ref|YP_503822.1|
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily PHP domain-like 5.1e-49
Family PHP domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603644|ref|YP_503822.1|
Sequence length 221
Comment PHP-like protein [Methanospirillum hungatei JF-1]
Sequence
MLKADLHIHTSCSKDGESTVAQVIAAAVTAGMDVIAITDHDTMDGYRIACEISADILIIP
GVEVSTREGHLIALGVEKAPLPGFPILDTIQEVRQAGGITILPHPFHRYRHGAALKCAEA
FGAADAIEVYNSRYVIPHANHRAMRLARTMGKPAVAGSDAHNARFIGYGRTLIDADRNIG
SVLNAIQEGKTKPAGRKTPVRIYTKQSLRNSWRKIRGRLHR
Download sequence
Identical sequences Q2FT00
323259.Mhun_2401 WP_011449361.1.85653 gi|88603644|ref|YP_503822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]