SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603723|ref|YP_503901.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603723|ref|YP_503901.1|
Domain Number 1 Region: 10-210
Classification Level Classification E-value
Superfamily PHP domain-like 8.5e-39
Family PHP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603723|ref|YP_503901.1|
Sequence length 216
Comment hypothetical protein Mhun_2482 [Methanospirillum hungatei JF-1]
Sequence
MYDFHTHTLLSDGDLLPTELLRRMQVLGYTVVGITDHVDAGNIDETLVSLGRVAKSAHTM
GIKLLRGVEITHVPPVEIPDLARYAKENGADIVVVHGESPVEPVMPGTNHAALSCPHVDI
LAHPGLITEEDATLARKHNIALEITARGGHNRTNGHVARIAEKTGCLMVVDSDAHHPGDL
MSGRDREIIAAGAGISSESLKSLLSTEGNEFFNRFT
Download sequence
Identical sequences Q2FU17
323259.Mhun_2482 WP_011449440.1.85653 gi|88603723|ref|YP_503901.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]