SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603863|ref|YP_504041.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603863|ref|YP_504041.1|
Domain Number 1 Region: 169-330
Classification Level Classification E-value
Superfamily TPR-like 3.79e-23
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Domain Number 2 Region: 29-104
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000785
Family PKD domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88603863|ref|YP_504041.1|
Sequence length 356
Comment tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
Sequence
MQDFNTGYILRRFTFIIALIFSLTFMVSAGPTYAPTEGKNPLKVYFTFPGGEECDSVKWN
FGDGNTSKAITTDHTYYSLGMYYPTCWCELPGANTSYTYDYVYVIPWSSSIRDSITGGRP
KQTVVNRTSVGLDFTSLKKQAQGLAAIGEMRYAADAYADLKSLGTLDSETLSSYGDVLTG
LGRLTEAEVIYNEALAEKDSAPILKKLADVLFSLGKTKEAIDVMNRTLVLAPDDAGAYAS
YASFLQKAGKTPEALDAFNQSFKLLDAQPEIWSEYADLLSSLGRYNEAADAYDHAIKLGM
FGSDIWNNYSRVLQKLGRKEEAQRAKEQAMNTYAPIALSRYSSSDSIPTCGIGSLC
Download sequence
Identical sequences Q2FTX8
gi|88603863|ref|YP_504041.1| WP_011449579.1.85653 323259.Mhun_2625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]