SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603869|ref|YP_504047.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603869|ref|YP_504047.1|
Domain Number 1 Region: 17-212
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.000000287
Family NanE-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603869|ref|YP_504047.1|
Sequence length 228
Comment hypothetical protein Mhun_2631 [Methanospirillum hungatei JF-1]
Sequence
MQLLVSPATIEEAKKALSADIVDVKRPEEGSLGASFPWIIRAIKDLTHKPVSAAIGDFDY
KPGGAALTALGAAAAGADYIKIGLMFDGIEEAEMLIHSVTRAVKETYPEKMVVIAAYSDW
ERLETISPYDMAPLAAKAGADISMVDTGIKDGKSTFEFMDETRLVEFTKLNQKLGIKTAL
AGSLKFEDIEILKRINPDIIGVRGMVCGGDRRAMVQEELVLKAVSMVH
Download sequence
Identical sequences A0A1V5SVN1 Q2FS88
WP_011449585.1.85653 323259.Mhun_2631 gi|88603869|ref|YP_504047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]