SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603873|ref|YP_504051.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603873|ref|YP_504051.1|
Domain Number 1 Region: 2-304
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.24e-46
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 
Weak hits

Sequence:  gi|88603873|ref|YP_504051.1|
Domain Number - Region: 351-409
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00568
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603873|ref|YP_504051.1|
Sequence length 430
Comment FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Methanospirillum hungatei JF-1]
Sequence
MRLARAGKKVQLIEKRSAGVGGQCLHQGCMIICALNDVARFMQQARVFQKYGFLGSAEGF
SYPVLIRKMQEIIKIIAGVLEEETIHAGVEIIRGSAEIQGRTLLINGVETPCEAVIVASG
AHPRIPEISGCCLPGVYTAHTILSMPSLPKRMVIIGSGVIAAEFAYIFSSFGTEVTILAR
SSLLRAFPEQLIKEARKDLSQVTIEEQVTIAGITGQESVTGVIIRENDGMREIAADAVLL
AAGMIPNTDFISDIACGPDGALLVNDRMETSVPGIYAAGDVTGTGYLTPIARHQGRKAAD
AILKNPFEPDPVAIPQAIKLKHDVAYCRRPGEVRKGLTIPGPAGPGTFWEVTNHHTGSAT
IEFDENGHLTGLAEASPVASVAMAYLGWMMNSDIRIDEFDRFIEVHPSPDGIPWLLKYLN
GKKSDNQKGS
Download sequence
Identical sequences Q2FS82
gi|88603873|ref|YP_504051.1| 323259.Mhun_2635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]