SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603960|ref|YP_504138.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603960|ref|YP_504138.1|
Domain Number 1 Region: 41-384
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 3.07e-52
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.0013
Further Details:      
 
Domain Number 2 Region: 384-574
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.7e-48
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88603960|ref|YP_504138.1|
Sequence length 581
Comment 5'-nucleotidase-like protein [Methanospirillum hungatei JF-1]
Sequence
MQRYPIMPVPPHHTLRIAGILAILYLISFFFIPTAADDQAFGPVKFHILAVNDFHGQLGP
GQKMNGSPAGSIPVLAGYLSDAIDTYGTNTTIIALPGDMTGASPAESNLLLDEPAILFMN
RFVTGDWKKPDTTETTGVRVIGTLGNHEFDRNLSELQRLINGGNDGTNITHLVDPYPGAL
WPVIAANIFWNGTDNLFLEPYVIEDIEGVPVAFIGAVTELTGEISEPGNVEQVAFTDEAD
AINAQVKVLQEQGIHAFVVLLHEGGSQTPYDGPTQETGDLSGRVTSIVMRLDEDVDVVLS
AHSHQFTNQYVPNAGGKPTLVTQAYSYSSAYADVTLELDPEMKDIVNKTATIVTAYADQG
AGFTPDENSQELLDAVNSTIAPLISEVIATTDIPLTRNPDENGESLLYDIATDAFRWDMK
TNISILNIGYLRADIDAGEITTGDAYSVMPFHDQIYSVQMTGQQIKDLLNQQWTRTVKPD
HLLQISGFSYFYDESRDPSDRVVNITIDGEEMDMNAYYTVATIDFLAHGGDGYTIMKEGT
LVGYGALDVDEFIAYLTYIPSPIHEQTGGRINRVDSGIEQE
Download sequence
Identical sequences Q2FTZ6
gi|88603960|ref|YP_504138.1| 323259.Mhun_2724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]