SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603996|ref|YP_504174.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603996|ref|YP_504174.1|
Domain Number 1 Region: 342-409,515-554
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000681
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603996|ref|YP_504174.1|
Sequence length 566
Comment tetratricopeptide TPR_2 [Methanospirillum hungatei JF-1]
Sequence
MTEEDPLSIVQVRYARGEIDTAEYEEFLSWFLKNISFQQVPSLKIASERYANGEITIGQY
KEIISHLLNDIGNYQQSAPLRAIHLRYAEGDIDTAEFEEKVGVLMRDIPAYPYNPPLAVL
FMRYAKGEIDNLRYQEMLTHLSTYCTPNLPSTPKEASTPPEPQKTSAPSPKPAAPPVGQK
PPASSPPPEAPQTPDPYRLNFAAVQNPPSPSPVGDVSAVHPDIHGGLPPEMDIGGLGGSG
SGVISEQQVMMEPARDITAERGSYHITDISTSATPVTVLVKPDMEIPKKETTISFKQNVS
EVKPEEEIGAKSDQESAPSAPAPEPDNIISEVATSPSGNHQKIKALIKQGKYYEAITRLD
EMLLESSDDYRSLFLKSIALFNIGKGDEALEILSKAKESCTNKDDAKEIERIYSHIVQKG
GSKNGQKKEKEKEKEKESAQSAQKDVGKVPSLTSHPERVKNEHSDLIEKICNQAQSLIDT
GDYKGANEILADIQGLVKDIPVEIMQKESIDDLFAAKGFVLYQLKEFCEAKKFFKEATRI
NPKNETAIHYLNDIRVRDCNKFVRHV
Download sequence
Identical sequences Q2FTP5
WP_011449711.1.85653 gi|88603996|ref|YP_504174.1| 323259.Mhun_2760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]