SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88604104|ref|YP_504282.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88604104|ref|YP_504282.1|
Domain Number 1 Region: 23-215
Classification Level Classification E-value
Superfamily eIF4e-like 2.47e-36
Family BLES03-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88604104|ref|YP_504282.1|
Sequence length 216
Comment hypothetical protein Mhun_2871 [Methanospirillum hungatei JF-1]
Sequence
MDAADTVELSDSAYAIFEFFFRSQLHMRKKSLSLIVESGEPFEELFHEIFTEFSTVYPEV
YDLLISQFQSPEEIYRMIREGEGVIPSKTYQARWIEQDSPHVDGRAADIEKAGKWLVFLP
PDQVDDIWRQIRDRTWEGTLGISAKVSTAKPDPDARDDRKVIYVYTADWEDEADVMRVRE
ELRRIGITDRIGYKRNIETFKGEYSAKGKKVTFYSA
Download sequence
Identical sequences A0A1V5SYH1 Q2FS37
323259.Mhun_2871 WP_011449816.1.85653 gi|88604104|ref|YP_504282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]