SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88604260|ref|YP_504438.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88604260|ref|YP_504438.1|
Domain Number 1 Region: 205-495
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 7.12e-110
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.00000326
Further Details:      
 
Domain Number 2 Region: 2-188
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 4.12e-63
Family Inosicase 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88604260|ref|YP_504438.1|
Sequence length 495
Comment phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Methanospirillum hungatei JF-1]
Sequence
MKRALLSVWNKDGIIDLARTLHQAGIELLSSGGTAKVLTASNIPIIEVSEYTGFPEMMDG
RVKTLHPKIHGGILGRRGTDDAIMKEHNIGPIDLVVVNLYPFEEMTKQSLPLDELIEFID
IGGPAMIRAAAKNFQDVLVVIDPADYPALMNAVSSKKSFSKEERLAYARKVFARMAAYDG
AISNYLYGLEEELPSVYSVQFRNGRMLRYGENPHQIAAVYGESGIGGSLPLQGKAMSYNN
YLDVDAAVGLLREFDECAAVIVKHNNPCGVATGEIIRDVYIAARDVDPVSAYGGIVAVNR
EVTPDLAKEIASTFIEVLVAPSFSEEAREILKTKENLRLLHLTDPAGHAAIRTIDGGALV
QVTPVQREEWRVVTDRDPTADEEAAMMLAMKVCKHVKSNAIIFADKNRALGIGAGQMSRV
DSAKIAISKAQFSLKGSVVASDAFLPFSDTLEVAAEAGATALIQPGGSIRDNEVIAEANR
RKMAMVFTGIRYFRH
Download sequence
Identical sequences Q2FSA5
WP_011449970.1.85653 323259.Mhun_3032 gi|88604260|ref|YP_504438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]