SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88604268|ref|YP_504446.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88604268|ref|YP_504446.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily CheY-like 1.15e-33
Family CheY-related 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88604268|ref|YP_504446.1|
Sequence length 131
Comment response regulator receiver domain-containing protein [Methanospirillum hungatei JF-1]
Sequence
MPTVLIIDDEDLDRKVLHSILLSAGYEVVGTARSGEEGIKLSRTLKPDLITIDLMMPKMN
GMEVLIKLMKENAKTNALICTSAHSDPVVDLAMRYGAKGYIIKPFQARSLLATVKEVVGA
PDPARMNVWNF
Download sequence
Identical sequences A0A1V5SRV8 Q2FS60
WP_011449978.1.85653 323259.Mhun_3040 gi|88604268|ref|YP_504446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]