SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|88604419|ref|YP_504597.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88604419|ref|YP_504597.1|
Domain Number 1 Region: 12-263
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.05e-53
Family Met-10+ protein-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88604419|ref|YP_504597.1|
Sequence length 265
Comment hypothetical protein Mhun_3196 [Methanospirillum hungatei JF-1]
Sequence
MGLRRDLTGIIPDDLLILLPDGYEIIGTIAIISIPPELTLFNEQIVTALRARRPSIQTIL
NKTGDVNGLFRTSQYTPIFGENTITEHREYGFRYRLDVSKVYFSSKMGSERKRIADLIKS
GETVFIPFAGVGPYAIPVAARGAEVLAIEINKSACSWMTINALENGVSSRLHIIRGDAMQ
ANQTLRRKFSRIIIPTPYGLLNGPDIFLSMLSEGGTVHWISFSNSMQMKEIIDRLTERGY
QVLRCHQCGNVAPSVYRWILDIKAK
Download sequence
Identical sequences Q2FUN7
gi|88604419|ref|YP_504597.1| WP_011450123.1.85653 323259.Mhun_3196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]