SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88601759|ref|YP_501937.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601759|ref|YP_501937.1|
Domain Number 1 Region: 6-120
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.87e-19
Family N-acetyl transferase, NAT 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88601759|ref|YP_501937.1|
Sequence length 134
Comment GCN5-likeN-acetyltransferase [Methanospirillum hungatei JF-1]
Sequence
MDDCKVDEVRALFHAGDWWEDEWDDSILCEIVRSSYAFVAAIGPDNRWIGMGRIISDGVS
DAYLQDIVVLPEWRDKGVGTAIVKKLMTICMHAGIGWIGIIAAPETEYFYRRFGFAKMNG
YTPMRYEGPIPARE
Download sequence
Identical sequences Q2FUC3
323259.Mhun_0456 WP_011447506.1.85653 gi|88601759|ref|YP_501937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]