SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88601896|ref|YP_502074.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88601896|ref|YP_502074.1|
Domain Number 1 Region: 976-1059
Classification Level Classification E-value
Superfamily PKD domain 4.05e-28
Family PKD domain 0.00024
Further Details:      
 
Domain Number 2 Region: 1230-1314
Classification Level Classification E-value
Superfamily PKD domain 1.18e-27
Family PKD domain 0.00035
Further Details:      
 
Domain Number 3 Region: 892-974
Classification Level Classification E-value
Superfamily PKD domain 1.57e-27
Family PKD domain 0.00028
Further Details:      
 
Domain Number 4 Region: 723-804
Classification Level Classification E-value
Superfamily PKD domain 2.09e-27
Family PKD domain 0.00056
Further Details:      
 
Domain Number 5 Region: 806-888
Classification Level Classification E-value
Superfamily PKD domain 2.75e-27
Family PKD domain 0.00028
Further Details:      
 
Domain Number 6 Region: 1061-1144
Classification Level Classification E-value
Superfamily PKD domain 5.89e-27
Family PKD domain 0.00035
Further Details:      
 
Domain Number 7 Region: 1147-1230
Classification Level Classification E-value
Superfamily PKD domain 2.62e-26
Family PKD domain 0.00037
Further Details:      
 
Domain Number 8 Region: 1404-1484
Classification Level Classification E-value
Superfamily PKD domain 7.46e-26
Family PKD domain 0.00032
Further Details:      
 
Domain Number 9 Region: 1318-1401
Classification Level Classification E-value
Superfamily PKD domain 6.54e-25
Family PKD domain 0.00056
Further Details:      
 
Domain Number 10 Region: 297-629
Classification Level Classification E-value
Superfamily NHL repeat 0.0000000798
Family NHL repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88601896|ref|YP_502074.1|
Sequence length 1862
Comment hypothetical protein Mhun_0597 [Methanospirillum hungatei JF-1]
Sequence
MMGNAKTVWCLILAIFLIAGTFVSADENAGDTQALQTKLASMPLVFIQNNGQFEDNVSYQ
TQSTDQVISFTDEGMEFSHNPGNSSVFMLLNGSNPDKKIIGLNPLNGTANFYYGSDPSAW
VIGAMLTSGVRYEDVYNGIDYIVSGTEGLLKSEFILDAGADPSQIMLVYQGHTGISLNET
TGDLVIETPARQIIDEAPVAYQEVNGTRTEVECSYVLGPDATVTFALGEYDPSLPLVIDP
VLRYSLYFGGDGRDQGNSIKVDKEGYAYFIGTSWSDHLKYFKNNAKDPLSNQNPPGTQQA
LSSGDVSVEGLAPGSIQPYFGGGEKDAFVVKVNPDGTDLVYISYLGGSGTDEGTGLVIDE
AGNAYITGGTNSPNFPTKNPYRNALAGGYDAWMAKLDPTGKELVFSTYFGGVHDDFGFDI
DIDKSHNVFVTGQTASWNFPVVNRYQLSPYGGLPDAFITKFTAEGNSIVYSNFIGGSAFD
AGTAVSVDSNGYACIVGQTESPNFLTIKPYQDKLRGPFDAFVTKFDPEGKYPAMYSTYLG
GSGTDDARDVISLPDGSLIVVGITKSKDFPTVNALQGELKGLQDGFITTLNADGSALTQS
TYFGGSLIDSITGAARDKDGNIYVVGTTNSPDIPVTLAYQSKPGGSSDVLIAKFNPAISQ
IGYATYLGGGSIDEGRAIDVLPEGEAYLTGYTESKNFPKVWPYQQNFGDGDRDAFIVSLS
EHDMIPVTDFEGVPTEGDAPLTVQFTDKSLGIPTSWAWEFGDGGTSTEKNPLHVYEKPGV
YTVSLTAKNIVSSQKKTKEDYIHVFEPVKPPVADFSANPTEGMVPLAVTFTDLSTNDPET
WSWVFGDGGTSTERNPVYTYNNPGTYTVNLTVSNRAGVSSKEKPEFIHAKPAVIPPVADF
NANPTSGMVPLAVTFTDASKNGPTAWKWTFGDGGSSAEQNPVYTYTVPGTYNVTLNCSNS
AGSDEITKPEFIHAQPAVIPPKADFNANPTSGMVPLAVTFTDLSKNGPTAWKWTFGDGGS
STEQNPVYTYTVPGTYNVTLNCSNSAGSDEITKPEFIHAQPAVIAPVAKFKGEPRNGTAP
LRVTFTDLSENGPTSWEWNFGDSQVSTEQNPVHVYEKAGKYTVSLTVKNSAGTDTLVEQN
YIIVNEPVLPPCADFSGAPREGKAPLTVTFLDLSKNSPKQWYWKFGDGTTSEERNPVHTY
PAEGKYTVELTVSNEGGADTKIAPDYITVTAPGFPPDAQFRGFPTSGTAPLTVSFTDLST
GDPTKWSWDFGDGSVSSDKHPEHTYTTPGEYSVTLTVENPFGMSTELREKYIRVYEKPVP
LKASFMGEPTSGKEPLTVQFTDLSTGNPETWMWNFGDDQTSTEKNPVHVYTKAGVYTVFL
TVTRGEDRSSEIRYQYITVLPAGKPPVPDFVASPTTGYVPLDVQFTDLSTDKPTAWRWDF
GDGQSSSEQHPVHRYMTPGSYTVCLEASNEFGSAATCKDNLIKVTEAPLAPAEFFGSITV
DGSPGCIGTIIEARGSGIDTGIFGNPVTTTIEGAYGTPDPLTVKGTIKNGDAITFWVKPQ
GKQDFVQAECYDVYAGKEWQKSYPYKGGSKTRLDLRVGEAPIPPMPVLPHEFYGEVTSNG
MPMPVGTMILVKGDNVVEGHRGNPLAVTSPGVYGFNELNKLVAQGDLKAGQPLTFWVIPA
GSGEPVMAQVRDVDASGEWASSYPYIEGGLTRLDIRIDGGTPPIPVVPMTISGTALVDGN
PITPGSLITADGKNVRVGIDGNPVSVGNNGRFGDGRKLTIQGDIQTGSPITFLMYDAACG
NQYVAEVKDPQTGIWVASIPFKPGADMELEIRSSSIIPADKKSNETPVITASVPEDDQVQ
TQ
Download sequence
Identical sequences Q2FLP4
323259.Mhun_0597 gi|88601896|ref|YP_502074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]