SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88602016|ref|YP_502194.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88602016|ref|YP_502194.1|
Domain Number 1 Region: 23-97,197-246
Classification Level Classification E-value
Superfamily TPR-like 0.00000000022
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 2 Region: 311-608
Classification Level Classification E-value
Superfamily TPR-like 0.000000000648
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|88602016|ref|YP_502194.1|
Sequence length 616
Comment hypothetical protein Mhun_0722 [Methanospirillum hungatei JF-1]
Sequence
MENIPNQEGQCWIDYLLTRITDLIKIQEYERALPIAEQALLMLPDNPDLIYLASTIYQNL
NKFVKQLRLLERLRDIRPFDQDRRSALGRSLMFQGYYYSALSVMSHFDMMSNELAGYNKV
FMHYCKACIGDTQSVIEYCDCCFEDYQDEPDAASFLAIIRALKVMSLIQNQENEAANSLA
CSIDEEFDKTLFVAYAKGIAARENNNLAAAERFLRLACTSNQRDMRARKELADLLSVLGH
HDAAANIRKEITGFFGPFDDHENPLYRAKEFIKSGNFDEAERYLLWVHEQQPDRNDLILP
MISLCNFTDRYDSVISYADSLETTPYAWKSGYLKASAYYSAGDAMGAIRCLIAAIARDRI
FSLITILNMRIEGYFRDPDIFDPDGMALMIFCTDGYDSAIPLFEMLVDTNPDILEYRAFL
VYCYILEDKNTDAAICSERLSMSDDPDLCMVRALALRAAGCLDEAKQVTEKTRKRYPDYL
PALNMYVRILVDLDLYRSAYFELLSYQDVLLSEAPLMEVFIRCLIHSGDFLEAATSAFRL
IMANPDRPLEFFFLAQTFMHDGYTDAALYAIRESFRFSGFNSKTLRLYVKLLLQAASPQE
ASIFFSECDDYFPEQS
Download sequence
Identical sequences Q2FPZ6
gi|88602016|ref|YP_502194.1| 323259.Mhun_0722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]