SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603183|ref|YP_503361.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603183|ref|YP_503361.1|
Domain Number 1 Region: 2-168
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.01e-42
Family N-acetyl transferase, NAT 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88603183|ref|YP_503361.1|
Sequence length 185
Comment GCN5-likeN-acetyltransferase [Methanospirillum hungatei JF-1]
Sequence
MHISTPSCILRTWSVSDAPSLSIHANNPDIARWMRDGFPSPYSRDDADRFIAMAQNEQIA
ILLAIEVDGEAVGGIGIHPLSDVYRRTAEIGYWLSQKYQGRGVVTDAVRACVPVVFATTD
IIRIQAGVFHTNLSSMRVLEKCGFEHEAVHTKAIWKHGQFLDEHLYVLFRDRYESRKEPN
ARTLN
Download sequence
Identical sequences Q2FM69
WP_011448904.1.85653 323259.Mhun_1931 gi|88603183|ref|YP_503361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]