SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603194|ref|YP_503372.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603194|ref|YP_503372.1|
Domain Number 1 Region: 186-421
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.27e-34
Family Pce catalytic domain-like 0.026
Further Details:      
 
Domain Number 2 Region: 11-78
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000474
Family Tetratricopeptide repeat (TPR) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|88603194|ref|YP_503372.1|
Sequence length 423
Comment beta-lactamase-like protein [Methanospirillum hungatei JF-1]
Sequence
MHADMAVDPDESRFDEGISLIKAGKIEEAIDIFSELVEKDDRNHKAWNAYGVALSQTIHK
ESAIHCFENALQLDPDNKIYQRNLNRTKNPPSKKTIRKKAELTPHKSGKRWIAPAVLLLL
AGVAVLIVSGLVPGVSVSDQVRSLIPGSGPVEEVPVITPEPVITPEVTPEPTPEPTPVPT
PLPEPETLFHFIDVSQGDAALIQSEGKNMLIDAGPKSSGPRLVEYLKRQNVTSLDYVVAS
HPFDDHIGGMVDVLKAFEVRTYVDNGMTHTSDLYKDVINAVISDQAVRMIVTAGMNIPFT
NTTKVDIIGPHRLTGHQDTDSLVLRVTMNNVSVIFPGDSSEVRGPATILKLPDHGSDAGI
GPIMNTRPEAVVISLASGNPFGYPRSATLTEIMKQGAQVFRTDVNGTIVIRTNGENWTAK
TVR
Download sequence
Identical sequences Q2FRH6
323259.Mhun_1942 WP_011448915.1.85653 gi|88603194|ref|YP_503372.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]