SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|88603746|ref|YP_503924.1| from Methanospirillum hungatei JF-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|88603746|ref|YP_503924.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily GlnB-like 1.97e-37
Family Prokaryotic signal transducing protein 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|88603746|ref|YP_503924.1|
Sequence length 110
Comment nitrogen regulatory protein P-II (GlnB, GlnK) [Methanospirillum hungatei JF-1]
Sequence
MKLIKAIIKPERLDAVKKALEDAGYFGMTITEVQGRGEQKGISLQYRGGTIEVDLIPKIE
MEILVSADKVDHVIETIKKGAYTGKIGDGRIFVIPVDASIKIRTGEVITE
Download sequence
Identical sequences A0A1V5SM61 Q2FS32
2005168270 2005417155 WP_011449463.1.85653 323259.Mhun_2505 gi|88603746|ref|YP_503924.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]