SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91774796|ref|YP_544552.1| from Methylobacillus flagellatus KT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91774796|ref|YP_544552.1|
Domain Number 1 Region: 109-231
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 8.25e-30
Family Aromatic dioxygenase reductase-like 0.0073
Further Details:      
 
Domain Number 2 Region: 211-309
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.06e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.018
Further Details:      
 
Domain Number 3 Region: 3-101
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.65e-21
Family Ferredoxin reductase FAD-binding domain-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91774796|ref|YP_544552.1|
Sequence length 317
Comment ferredoxin [Methylobacillus flagellatus KT]
Sequence
MSHLNVIVSAIADVAEGIRHFTLVDAAGRELPGFSGGSHVVVSMRAGARTYRNAYSLLSP
PSDRSNYQIAVRLQENSRGGSRFMHEQVQVGTALEIAWPVNLFAISRVGRKHILVAGGIG
ITPFMSQAHDLLRTGANFELHYAFRSPRHAAFVDELRRLLGPRLKCYDQSQGQLLDPAAL
LSHQPLGTHVYVCGPGGMVDAVLDTAARLGWPDAHVHHEEFLAPPVGEPFAIRLAQSQRV
VEVGAEESMLEAMEAAGVDVPYLCRGGACGRCELEVLATDGVLEHHDHYLSEDERRAGNK
IMPCVSRAKCTFIELNL
Download sequence
Identical sequences Q1H476
gi|91774796|ref|YP_544552.1| WP_011478808.1.99167 265072.Mfla_0441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]