SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91776407|ref|YP_546163.1| from Methylobacillus flagellatus KT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91776407|ref|YP_546163.1|
Domain Number 1 Region: 213-431,484-665
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 8.41e-87
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00026
Further Details:      
 
Domain Number 2 Region: 76-211
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 2.18e-37
Family Ferredoxin domains from multidomain proteins 0.00013
Further Details:      
 
Domain Number 3 Region: 1-74
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.07e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0091
Further Details:      
 
Domain Number 4 Region: 721-780
Classification Level Classification E-value
Superfamily ADC-like 0.00000000956
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91776407|ref|YP_546163.1|
Sequence length 808
Comment NADH dehydrogenase subunit G [Methylobacillus flagellatus KT]
Sequence
MLNIEIDGKQVEVEHGSTIIDAADQLGIPIPRFCYHKKLSVAANCRMCLVQVEKFNKPLP
ACATPVADGMKIFTRSKAAVEAQQSVMEFLLINHPLDCPICDQGGECDLQDIAVAYGAPA
SRYTEEKRVVLNKNIGPLVATDMTRCIQCTRCVRFLKEVGGMMELGLINRGEHAEITAYV
DKSVDSELSGNIIDLCPVGALTSKPFRYKARTWELIRRPSIAPHDGLGSHIEVHVKDGKV
LRVLPREKETINECWLSDRDRFSYEGLNSPDRLKVPMVKHNGVWHETDWKTALELAAGQI
KDIVNNEGGDALGVLVSPNSTMEEAYLATRFANGLGSDNVDYRLRHADFRHDGKRLGVIW
MGCNIPEVQEMDRILVIGSNLRNEHPLLAQRIRRAVANGAELSVVNPLDDDPLIPVKHKA
ICSPNDMVNVLSQILKAVSGMERLSLCLPKSLSELLEGVRVWDNSKAIALSLTGHGETMD
LVSPRSAVFLGNISQHHPRYTEIYSLAEAIASLCGATFGVLSAGANSVGANLVGAMPKAG
GLNARTMLESPRKAYMLVNVEPELDCGNPSLAVNALQQAECVVVLTAYRSDALERDADIL
LPIVPFTETSGTFMSMEGRVQSFTAVTKALGEARPGWKVLRVLGNLAGVSRFDFDSTEQI
KNEIFCGEKPSAVVWRTLNNNLRELIDVEVKVKLDSDLQRVGEIPQFQSDGIVRRSPPLQ
KTRHVVKAVLAALHPEQMQKLGIKEGERILVRQGNGSAVLEAHADARVPHGCVRVPGALP
QTAGLGDLLGEISVERIPVEQPADEVVA
Download sequence
Identical sequences Q1GZL5
265072.Mfla_2055 WP_011480276.1.99167 gi|91776407|ref|YP_546163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]