SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91776783|ref|YP_546539.1| from Methylobacillus flagellatus KT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91776783|ref|YP_546539.1|
Domain Number 1 Region: 35-164
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000309
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|91776783|ref|YP_546539.1|
Sequence length 187
Comment hypothetical protein Mfla_2433 [Methylobacillus flagellatus KT]
Sequence
MAAKTVKKQLPYFLLVFLIPVTLVLWWWGLFSSADVEIAERGNYRYAYLEADGPYSKLSS
KQEEVLHELVDQNIQPGPEITLIFSDPRTTPYKELHARAGFIIDADAKPVAPIQVDTVPV
RKVFVASIKAHPLLAYGKTYSKVLEFVKSKDMPLNLPTVEIVDDSVLSVEMPLNPVPESQ
PNAGVSP
Download sequence
Identical sequences Q1GYI9
gi|91776783|ref|YP_546539.1| 265072.Mfla_2433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]