SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83589801|ref|YP_429810.1| from Moorella thermoacetica ATCC 39073

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83589801|ref|YP_429810.1|
Domain Number 1 Region: 4-153
Classification Level Classification E-value
Superfamily RNase III domain-like 1.53e-47
Family RNase III catalytic domain-like 0.00013
Further Details:      
 
Domain Number 2 Region: 118-230
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.89e-20
Family Double-stranded RNA-binding domain (dsRBD) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83589801|ref|YP_429810.1|
Sequence length 233
Comment ribonuclease III [Moorella thermoacetica ATCC 39073]
Sequence
MDNKRQEQLQHFWEQFHLPAIDLEGLDLALTHPTYAFEHHLPGDNQRLEFLGDAVLGLVV
ATYLYQHFPQLPEGDLTRMRAAVVCEASLVKVARRLRVGDLLRLGQGEEHSGGRERPSNL
ADAMEAIIGSVYLSGGYELARDFVLQIFTPALEILSDTSFIDSKSALQEFVQSQGTENVV
YKILEEWGPDHAKGYKAGVFLKNRLLATGLGHSKKEAEREAARAALALLKVQG
Download sequence
Identical sequences A0A0S6UGL7 A0A1J5K253 Q2RJX2
264732.Moth_0951 WP_011392467.1.11833 WP_011392467.1.17212 WP_011392467.1.24029 WP_011392467.1.35666 WP_011392467.1.46409 WP_011392467.1.52901 WP_011392467.1.64341 WP_011392467.1.90723 YP_429810.1.14147 gi|83589801|ref|YP_429810.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]