SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83590421|ref|YP_430430.1| from Moorella thermoacetica ATCC 39073

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83590421|ref|YP_430430.1|
Domain Number 1 Region: 39-135
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000000000497
Family Apolipoprotein 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|83590421|ref|YP_430430.1|
Sequence length 164
Comment hypothetical protein Moth_1581 [Moorella thermoacetica ATCC 39073]
Sequence
MAAVPEDIIKEIEKGRKEVSAGEEKTVDFGFYLLLDRIGSIKSDLQKQISDLQQQMMEVK
EDLRQEIKQEVNGLHQEMKQEVNGLRQEMKQENNSLRQEMKQEINGVRQEIKQEIDTLRQ
ELKDDIRHIDGKLNNVIWAAIGTFFAVLVGAAGIVVAIYYTAPK
Download sequence
Identical sequences A0A1J5NXT2 Q2RI52
gi|83590421|ref|YP_430430.1| WP_011393087.1.52901 WP_011393087.1.64341 WP_011393087.1.90723 YP_430430.1.14147 264732.Moth_1581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]