SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83591259|ref|YP_431268.1| from Moorella thermoacetica ATCC 39073

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83591259|ref|YP_431268.1|
Domain Number 1 Region: 80-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.83e-26
Family Translational machinery components 0.00014
Further Details:      
 
Domain Number 2 Region: 9-76
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.93e-24
Family Ribosomal S5 protein, N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83591259|ref|YP_431268.1|
Sequence length 166
Comment 30S ribosomal protein S5 [Moorella thermoacetica ATCC 39073]
Sequence
MARIEARELDLTEKVVSVNRVAKVVKGGRRFSFAALVVVGDGKGHVGAGLGKASEVPEAI
RKGIEDAKKNLIKVPMVGTTIPHEIIGHFGAGKVLLKPAAPGTGVIAGGPVRAVLEAAGI
RDILTKSLGSANPNNAVYATIEGLKGLKRAEEVARLRGKTVAELIG
Download sequence
Identical sequences A0A1D7XES1 Q2RFR4
gi|83591259|ref|YP_431268.1| 264732.Moth_2443 WP_011393920.1.15954 WP_011393920.1.17212 WP_011393920.1.24029 WP_011393920.1.35666 WP_011393920.1.46409 WP_011393920.1.52901 WP_011393920.1.64341 WP_011393920.1.79026 WP_011393920.1.90723 YP_431268.1.14147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]