SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83589287|ref|YP_429296.1| from Moorella thermoacetica ATCC 39073

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83589287|ref|YP_429296.1|
Domain Number 1 Region: 151-274
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000424
Family Phosphate binding protein-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83589287|ref|YP_429296.1|
Sequence length 335
Comment TRAP dicarboxylate transporter, DctP subunit [Moorella thermoacetica ATCC 39073]
Sequence
MFKWKKLILPLLLLIAMLIMSACGKSPADKQQDSNTYTLKIHMVINEQDPIYQGYAEFKK
GVEARTNGKVKVELYPNGVLGNDEDLLQQAMLGGNVAVNSDAGRLGVWVPEMGILLAPYL
TDNANEMQKLLKSDLVKKWTDELAQKKGLTVLSFNYYAGARHFITKKPISTPEDLNGLKI
RTPGSPVWQETIKAMGATPVALPWTETYPAIEQGVIDGAEAQDSATYGAKIYEVAKYITK
TGHIQLWNCLVVGTKWFEQLPKEYQQILIEESIKAGDFTTNKVLASEKELEDKMAATGAI
IKEVDIKPFKTKSEIVYSKLNYQDLRQEVNKVLGK
Download sequence
Identical sequences A0A1J5JSH6 Q2RLD6
gi|83589287|ref|YP_429296.1| WP_011391960.1.24029 WP_011391960.1.46409 WP_011391960.1.52901 WP_011391960.1.90723 YP_429296.1.14147 264732.Moth_0422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]