SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83590521|ref|YP_430530.1| from Moorella thermoacetica ATCC 39073

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83590521|ref|YP_430530.1|
Domain Number 1 Region: 35-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.6e-74
Family Phosphate binding protein-like 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83590521|ref|YP_430530.1|
Sequence length 304
Comment substrate-binding region of ABC-type glycine betaine transport system [Moorella thermoacetica ATCC 39073]
Sequence
MRQKSKRVGKLIALFTGIAMLLFVAAGCSGTRAKGTVVVGSKDFTENILLGEIMAQLIEA
HTDLKVERKLNLGGTLVNFNALKKGDLDLYADYTGTGLVAILKRDVINDPQEAYDAVQKA
YNEQFKLKWLKPFGFNNTYALAVPEEVARQRNLQKISDLKSVAGEMVLGAEQEFFNRPDG
YDGLIVTYGLNFKSTKQMETGLKYEAIHNKMVDVIDAFATDGQLITYKLKILEDDKQFFP
PYFAAPLVRMDTLEKYPQLEEVLNKLAGQLNDDEMRQLNYQVDEEKKEVAQVARDFLLKK
GLIK
Download sequence
Identical sequences A0A1J5NQG0 Q2RHV2
WP_011393187.1.17212 WP_011393187.1.52901 WP_011393187.1.90723 YP_430530.1.14147 264732.Moth_1685 gi|83590521|ref|YP_430530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]