SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83590658|ref|YP_430667.1| from Moorella thermoacetica ATCC 39073

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83590658|ref|YP_430667.1|
Domain Number 1 Region: 41-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.42e-61
Family Phosphate binding protein-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83590658|ref|YP_430667.1|
Sequence length 275
Comment molybdenum ABC transporter, periplasmic molybdate-binding protein [Moorella thermoacetica ATCC 39073]
Sequence
MKLRRASILIASTLIAALALAGCRQVATPQPRQQGQQPGGQLVVFAAASLTDAFGEIGRA
FEKSHPGVTVKFNFGGSQQLRTQIEQGMSADVFASANQKYMQELVAKGLVEPPRDFTANT
LTVIVPKNNPAGIKSAADLANKGKLVLAAPDVPIGKYSRQALEKLATLYGSDYPKQVEKR
VVSQETTVRQVVAKVALGEADAGIVYVTDINSSYRDKLDTIPFPQEANVRATYPIAVVKD
SKQAGLARELVNLILSPDGQKILAKYGFLPVKEGS
Download sequence
Identical sequences A0A1J5NFK2 Q2RHG5
WP_011393324.1.24029 WP_011393324.1.52901 WP_011393324.1.90723 YP_430667.1.14147 gi|83590658|ref|YP_430667.1| 264732.Moth_1824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]