SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|83590679|ref|YP_430688.1| from Moorella thermoacetica ATCC 39073

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83590679|ref|YP_430688.1|
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.08e-75
Family Phosphate binding protein-like 0.0000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|83590679|ref|YP_430688.1|
Sequence length 286
Comment hypothetical protein Moth_1845 [Moorella thermoacetica ATCC 39073]
Sequence
MDWPRLGRVGYLNCLPLFYPLETGRVKLPARIVADHPAVLNKAFRQGELEVTAVSSLAYG
QFAEDALVLPGLSISCRGRVGSVFLLSRVPAKELGGRPLSLTPYSATSVVLLRILLQRLY
HVAPDFFTRPTGSPPDWGRPEALLTIGDEALQVVRTGCYPFVYDLGEEWYRLTGKPMVFA
LWVARKDFAAAHPEKLAAIWRALQEAKAWGKGHPGTLAATGARHLGVEPEFIEDYFALLN
YDLDWPHLEGLLTFYGLAHGEGFLAHPVALEIWGVDNERNYRLQSA
Download sequence
Identical sequences A0A1J5NEA0 Q2RHE4
264732.Moth_1845 gi|83590679|ref|YP_430688.1| WP_011393345.1.24029 WP_011393345.1.52901 WP_011393345.1.90723 YP_430688.1.14147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]