SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91772170|ref|YP_564862.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91772170|ref|YP_564862.1|
Domain Number 1 Region: 6-86
Classification Level Classification E-value
Superfamily L-aspartase-like 8.92e-17
Family L-aspartase/fumarase 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|91772170|ref|YP_564862.1|
Sequence length 92
Comment fumarate hydratase class II [Methanococcoides burtonii DSM 6242]
Sequence
MGGSHIRSERDTLGEIEVPEDVYYGPQTVRTINNFKISRQRLPSSFIRAQAAIKLASARA
NLEAGKLEPEIAKAIISAASEVREGNLRTGKA
Download sequence
Identical sequences Q12ZL4
WP_011498276.1.71292 gi|91772170|ref|YP_564862.1| 259564.Mbur_0093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]