SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|91772685|ref|YP_565377.1| from Methanococcoides burtonii DSM 6242

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|91772685|ref|YP_565377.1|
Domain Number 1 Region: 129-242
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.09e-22
Family MJ1460-like 0.048
Further Details:      
 
Domain Number 2 Region: 18-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000648
Family MarR-like transcriptional regulators 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|91772685|ref|YP_565377.1|
Sequence length 244
Comment 4-vinyl reductase, 4VR [Methanococcoides burtonii DSM 6242]
Sequence
MEPDGQTALFSTQNGIIAIEGPVKLQIMELLYETAQSFDDIVKHTGKAKSTISVHLKDLK
ASNLLEEHVDPDDRRKKTYVMCSQYTACSQKPVFDHYRKNLEEFTTSFDSEGGLLRSMFR
TVQSGFHANGFNQTPIMENIGQDIGMKIAETFTSTYIEGLFEEVTDYWQKNEMGKLTVRS
YDPLIINIKDSFICEGTKNIGQTLCSFNEGILQGIILNKMNLQCNIVETECCGTGHGHCL
FVMQ
Download sequence
Identical sequences Q12Y49
WP_011498786.1.71292 gi|91772685|ref|YP_565377.1| 259564.Mbur_0656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]